PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011071866.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family Dof
Protein Properties Length: 330aa    MW: 36230.2 Da    PI: 6.9434
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011071866.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof127.24.9e-4057117262
          zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                     +e++lkcprCdst+tkfCyynnyslsqPryfCk+CrryWtkGG+lrn+PvGgg+rknkk+s
  XP_011071866.1  57 HEQSLKCPRCDSTHTKFCYYNNYSLSQPRYFCKTCRRYWTKGGTLRNIPVGGGCRKNKKVS 117
                     57899*****************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074784.0E-2851111IPR003851Zinc finger, Dof-type
PfamPF027011.9E-3359115IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.18961115IPR003851Zinc finger, Dof-type
PROSITE patternPS0136106399IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010067Biological Processprocambium histogenesis
GO:0010087Biological Processphloem or xylem histogenesis
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 330 aa     Download sequence    Send to blast
MGITSLQVCM DSSDWLQGTI SEEGTGMDSS PITTPSGDDS ILACSRPLIE RRLRPPHEQS  60
LKCPRCDSTH TKFCYYNNYS LSQPRYFCKT CRRYWTKGGT LRNIPVGGGC RKNKKVSSSK  120
KPSSSSSSDH QIHQNHSSSS SSSPLILNQS PMLPYNNIPS SSDHLQLGNY PDHHHHQLQF  180
SSSLGLLAPN PTPIDFMMEN KYDDAFMGNG GIMPGQSFAA DFHGICSPFG FSSLDHGINS  240
AAAGSSVLES CQRLMLPYDE NHGHHLDHQN HHEIHDVKPN AKILSLEWHD QQQACNPDAG  300
KDTFGYNFGG LGSWTGLMNG YGSSATNPLV
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00580DAPTransfer from AT5G62940Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3763885e-51AK376388.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3122H18.
GenBankAM0843605e-51AM084360.1 Hordeum vulgare subsp. vulgare dof12 gene for dof zinc finger protein 12, exons 1-2.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011071866.10.0PREDICTED: dof zinc finger protein DOF5.6 isoform X2
SwissprotQ9FM031e-61DOF56_ARATH; Dof zinc finger protein DOF5.6
TrEMBLA0A061FUJ41e-107A0A061FUJ4_THECC; F-box family protein isoform 2 (Fragment)
TrEMBLA0A061FV521e-107A0A061FV52_THECC; Dof-type zinc finger DNA-binding family protein isoform 1
STRINGPOPTR_0015s08810.12e-99(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62940.12e-48Dof family protein